CAS Number: 119911-68-1
Molecular Weight: 3130.68
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2
Storage: -20 °C or below
Calcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors.
Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP-α) and CGRP II (CGRP-β)
![Angiotensin II-[Sar1], CAS 51833-69-3 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-65.jpg)
![Angiotensin I [Asn1,Val5,Asn9], salmon - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-40-e1574455713389.jpg)
![Sarilesin (Angiotensin II [Sar1,Ile8]), CAS 37827-06-8 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-63.jpg)