CAS Number: 74870-06-7
Molecular Weight: 4419.17
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH
Storage: -20 °C or below
Oxyntomodulin, aka Glucagon-37, is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion. Oxyntomodulin injected directly into the hypothalamic paraventricular nucleus has been show to inhibit food intake in fasted and nonfasted animals in a potent and sustained manner.
