Galanin, rat

CAS Number: 114547-31-8 Molecular Weight: 3162. [Read More...]

Description
Additional Information

CAS Number: 114547-31-8
Molecular Weight: 3162.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Storage: -20 °C or below

Galanin is a non-selective agonist that binds the GAL1, GAL2, and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.

Categories	Peptides
Filter	Metabolic / Diabetes, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (475-25) quantity	0.5 mg (475-25)	$197
1 mg (475-25) quantity	1 mg (475-25)	$293
5 mg (475-25) quantity	5 mg (475-25)	$1,161

Galanin, rat

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Galanin, rat

Related Products

Angiotensin (1-7)

Angiotensin II-[Sar1]

Angiotensin I [Asn1,Val5,Asn9], salmon

Angiotensin II, human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register