CAS Number: 88384-73-0
Molecular Weight: 5105.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2
Storage: -20 °C or below
Growth Hormone Releasing Factor (GRF) (1-44), is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. This is the porcine form.
![Angiotensin II-[Sar1], CAS 51833-69-3 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-65.jpg)
![Sarilesin (Angiotensin II [Sar1,Ile8]), CAS 37827-06-8 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-63.jpg)
![Angiotensin III, human / Angiotensin II-[Des Asp1], CAS 13602-53-4 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-76.jpg)
![Angiotensin I [Val5,Asn9], bullfrog](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-36-e1574459651494.jpg)