Beta Amyloid [Gln 22] (1-40), human

CAS Number: 144410-00-4 Molecular Weight: 4326. [Read More...]

Description
Additional Information

CAS Number: 144410-00-4
Molecular Weight: 4326.19
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Categories	Peptides
Filter	Alzheimer's, Central Nervous System
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (640-20) quantity	0.5 mg (640-20)	$324
1 mg (640-20) quantity	1 mg (640-20)	$459

Beta Amyloid [Gln 22] (1-40), human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Beta Amyloid [Gln 22] (1-40), human

Related Products

ACTH (1-39), rat

Angiotensin I (human)

Angiotensin II-[Sar1]

Angiotensin (1-7)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register