![Beta Amyloid [Nle35] (1-40), human - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/641-13-Beta-Amyloid-Nle35-1-40-human.jpg "641-13 Beta Amyloid [Nle35] (1-40), human")
Molecular Weight: 4309.22
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Nle-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OH
Storage: -20 °C or below
Beta amyloid (1-40), along with beta amyloid (1-42), is one of the two main variants of the amyloid β peptide involved in Alzheimer’s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer’s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Nle instead of Met at position 35 resulting in a peptide that has the same propensity to aggregate but is non-toxic to hippocampal neurons.
![Angiotensin III, human / Angiotensin II-[Des Asp1], CAS 13602-53-4 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-76.jpg)
