Beta Amyloid [Glp3] (3-42), human

CAS Number: 183449-57-2 Molecular Weight: 4309. [Read More...]

Description
Additional Information

CAS Number: 183449-57-2
Molecular Weight: 4309.94
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glp-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Sequence (1-letter): (Glp)FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Storage: -20 °C or below
Alternate Name: (Pyr³)-Amyloid β-Protein (3-42)

Beta Amyloid [Glp3] (3-42) is a major component of of β-amyloid protein found in the brains of patients with Alzheimer′s disease and Down′s syndrome. It is suggested to accumulate in the brain and trigger beta amyloid plaque deposits.