Big Endothelin-2 (1-37), human

CAS Number: 132699-72-0 Molecular Weight: 4184. [Read More...]

Description
Additional Information

CAS Number: 132699-72-0
Molecular Weight: 4184.89
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-OH [Cys1-Cys15, Cys3-Cys11]
Sequence (1-letter): CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
Storage: -20 °C or below

Big Endothelin-2 is the precursor to the vasoconstricting peptide Endothelin-2 (ET-2). It is hydrolyzed by endothelin converting enzyme (ECE).

Categories	Peptides
Filter	Cardiovascular, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (331-40) quantity	0.5 mg (331-40)	$395
1 mg (331-40) quantity	1 mg (331-40)	$655

Big Endothelin-2 (1-37), human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Big Endothelin-2 (1-37), human

Related Products

Angiotensin II Antipeptide

Angiotensin II-[Sar1]

Atrial Natriuretic Peptide (1-28), human / ANP (1-28), human

Angiotensin (1-5)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register