CAS Number: 95751-30-7
Molecular Weight: 4298.92
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH [Cys7-Cys28, Cys13-Cys33, Cys17-35]
Sequence (1-letter): (Glp)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OH
Storage: -20 °C or below
Charybdotoxin is a potent neurotoxin isolated from the deathstalker scorpion, Leiurus quinquestriatus hebraeus. Charybdotoxin depolarizes peripheral T lymphocytes by binding to Ca2+-activated K+ channels and blocks their mitogen-induced proliferation.
![Angiotensin III, human / Angiotensin II-[Des Asp1], CAS 13602-53-4 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-76.jpg)
