Corticotropin Releasing Factor (CRF), bovine

CAS Number: 92307-52-3 Molecular Weight: 4697. [Read More...]

Description
Additional Information

CAS Number: 92307-52-3
Molecular Weight: 4697.34
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.

Categories	Peptides
Filter	Central Nervous System
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (353-26) quantity	0.5 mg (353-26)	$166
1 mg (353-26) quantity	1 mg (353-26)	$299

Corticotropin Releasing Factor (CRF), bovine

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Corticotropin Releasing Factor (CRF), bovine

Related Products

Angiotensin II-[Sar1]

Bradykinin Potentiating Factor (Angiotensin Converting Enzyme Inhibitor)

Tyr(PO3H2)4 Angiotensin II, human

ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register