Corticotropin Releasing Factor (CRF), ovine

CAS Number: 79804-71-0 Molecular Weight: 4667. [Read More...]

Description
Additional Information

CAS Number: 79804-71-0
Molecular Weight: 4667.51
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (352-26) quantity	0.5 mg (352-26)	$247
1 mg (352-26) quantity	1 mg (352-26)	$419

Corticotropin Releasing Factor (CRF), ovine

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Corticotropin Releasing Factor (CRF), ovine

Related Products

ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Angiotensin (1-7)

Angiotensin I [Asn1,Val5,Asn9], salmon

Angiotensin II Antipeptide

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register