Exendin 3

CAS Number: 130357-25-4 Molecular Weight: 4200. [Read More...]

CAS Number: 130357-25-4
Molecular Weight: 4200.03
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence (1-letter): HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage: -20 °C or below

Exendin-3 is a member of the glucagon family that has secretin-like biological activity when binding to the exendin receptor.

Publications

Categories	Peptides
Filter	Metabolic / Diabetes, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (507-79) quantity	0.5 mg (507-79)	$293
1 mg (507-79) quantity	1 mg (507-79)	$459

Exendin 3

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Exendin 3

Related Products

Angiotensin II-[Sar1]

Sarilesin - Angiotensin II [Sar1,Ile8]

ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Renin Substrate I

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register