Exendin 3 (9-39) Fragment

CAS Number: 133514-43-9 Molecular Weight: 3367. [Read More...]

Description
Additional Information

CAS Number: 133514-43-9
Molecular Weight: 3367.69
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence (1-letter): DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage: -20 °C or below

Exendin 3 (9-39) is a truncated form of Exendin 4 that acts as a potent and selective GLP-1 receptor antagonist.

Categories	Peptides
Filter	Metabolic / Diabetes, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (507-81) quantity	0.5 mg (507-81)	$269
1 mg (507-81) quantity	1 mg (507-81)	$379

Exendin 3 (9-39) Fragment

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Exendin 3 (9-39) Fragment

Related Products

Sarilesin - Angiotensin II [Sar1,Ile8]

ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

ACTH (1-39), rat

Angiotensin I [Val5,Asn9], bullfrog

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register