CAS Number: 99658-04-5
Molecular Weight: 4109.02
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Storage: -20 °C or below
Glucagon-like peptide-1 (GLP-1, Preproglucagon 72-107) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon.
![Sarilesin (Angiotensin II [Sar1,Ile8]), CAS 37827-06-8 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-63.jpg)