Growth Hormone Releasing Factor, GRF (1-44) amide, human bovine

CAS Number: 88894-91-1 Molecular Weight: 5107. [Read More...]

Description
Additional Information

CAS Number: 88894-91-1
Molecular Weight: 5107.86
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Storage: -20 °C or below

Growth Hormone Releasing Factor (GRF or GHRF), is released by the hypothalamus to stimulate the secretion of growth hormone. The bovine form shares ~90% identity with human GRF.

Categories	Peptides
Filter	Metabolic / Diabetes, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (535-15) quantity	0.5 mg (535-15)	$293
1 mg (535-15) quantity	1 mg (535-15)	$459

Growth Hormone Releasing Factor, GRF (1-44) amide, human bovine

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Growth Hormone Releasing Factor, GRF (1-44) amide, human bovine

Related Products

Angiotensin II-[Sar1]

Angiotensin (1-5)

ACTH (1-17), human

Sarilesin - Angiotensin II [Sar1,Ile8]

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register