Growth Hormone Releasing Factor (GRF) (1-29) amide, human

CAS Number: 86168-78-7 Molecular Weight: 3355. [Read More...]

Description
Additional Information

CAS Number: 86168-78-7
Molecular Weight: 3355.82
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Storage: -20 °C or below

Growth Hormone Releasing Factor (GHRF or GRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.

Categories	Peptides
Filter	Metabolic / Diabetes, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (531-75) quantity	0.5 mg (531-75)	$127
1 mg (531-75) quantity	1 mg (531-75)	$190

Growth Hormone Releasing Factor (GRF) (1-29) amide, human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Growth Hormone Releasing Factor (GRF) (1-29) amide, human

Related Products

C-Type Natriuretic Peptide (CNP) (1-22), human

Bradykinin Potentiating Factor (Angiotensin Converting Enzyme Inhibitor)

Angiotensin II-[Sar1]

Angiotensin (1-5)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register