Leumorphin (human) (Preproenkephalin B 226-254)

Molecular Weight: 3349. [Read More...]

Description
Additional Information

Molecular Weight: 3349.65
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH
Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYSGELFDA-OH
Storage: -20 °C or below

Leumorphin is an endogenous opioid peptide which corresponds to the 226-254 fragment of Preproenkephalin B. It is also known as Dynorphin B_1-29. Leumorphin is potent and selective κ-opioid receptor agonist.

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (271-35) quantity	0.5 mg (271-35)	$166
1 mg (271-35) quantity	1 mg (271-35)	$254

Leumorphin (human) (Preproenkephalin B 226-254)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Leumorphin (human) (Preproenkephalin B 226-254)

Related Products

Angiotensin I [Asn1,Val5,Asn9], salmon

ACTH (1-17), human

Angiotensin (1-7)

Angiotensin I [Asn1,Val5], goosefish

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register