Neuropeptide Y (3-36), human, rat / NPY (3-36)

CAS Number: 150138-78-6 Molecular Weight: 4008. [Read More...]

Description
Additional Information

CAS Number: 150138-78-6
Molecular Weight: 4008.98
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence (1-letter): SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Storage: -20 °C or below

Neuropeptide Y (NPY) is a 36-aa neuropeptide that acts as a neurotransmitter in the brain and in the autonomic nervous system of humans. It binds to a family of g-protein coupled receptors, Y1-Y6, to regulate a variety of functions including feeding behavior and pain perception. Neuropeptide Y (3-36) binds selectively to Y1 and Y5.

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (614-41) quantity	0.5 mg (614-41)	$174
1 mg (614-41) quantity	1 mg (614-41)	$261

Neuropeptide Y (3-36), human, rat / NPY (3-36)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Neuropeptide Y (3-36), human, rat / NPY (3-36)

Related Products

Angiotensin I [Val5,Asn9], bullfrog

Tyr(PO3H2)4 Angiotensin II, human

Angiotensin I [Asn1,Val5], goosefish

Angiotensin I [Asn1,Val5,Asn9], salmon

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register