CAS Number: 127317-03-7
Molecular Weight: 3145.66
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Storage: -20 °C or below
Pituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R, VPAC1-R, and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator.
![Angiotensin I [Asn1,Val5,Asn9], salmon - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-40-e1574455713389.jpg)
