Molecular Weight: 3842.03
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence (1-letter): EIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH
Storage: -20 °C or below
Parathyroid Hormone (4-34) is a N-terminal truncated form of the full length Parathyroid Hormone (PTH). PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.
![Angiotensin I [Val5,Asn9], bullfrog](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-36-e1574459651494.jpg)
