PHI, rat

CAS Number: 96849-38-6 Molecular Weight: 3009. [Read More...]

Description
Additional Information

CAS Number: 96849-38-6
Molecular Weight: 3009.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2
Sequence (1-letter): HADGVFTSDYSRLLGQISAKKYLESLI-NH2
Storage: -20 °C or below

PHI, aka Intestinal peptide PHI-27, is a member of the vasoactive intestinal peptide (VIP) family of peptides. It is has been shown to regulate feeding behavior and prolactin secretion.

Categories	Peptides
Filter	Gastrointestinal
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (495-25) quantity	0.5 mg (495-25)	$214
1 mg (495-25) quantity	1 mg (495-25)	$293

PHI, rat

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

PHI, rat

Related Products

Bradykinin Potentiating Factor (Angiotensin Converting Enzyme Inhibitor)

ACTH (1-24), human

Angiotensin I [Val5,Asn9], bullfrog

Angiotensin I (human)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register