CAS Number: 83930-33-0
Molecular Weight: 4866.46
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
Storage: -20 °C or below
Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors.
Publication
Powered by Bioz
![Angiotensin III, human / Angiotensin II-[Des Asp1], CAS 13602-53-4 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-76.jpg)
![Angiotensin I [Val5,Asn9], bullfrog](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-36-e1574459651494.jpg)
