Urotensin I, suckerfish

CAS Number: 83930-33-0 Molecular Weight: 4866. [Read More...]

CAS Number: 83930-33-0
Molecular Weight: 4866.46
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
Storage: -20 °C or below

Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors.

Publication

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (817-30) quantity	0.5 mg (817-30)	$214
1 mg (817-30) quantity	1 mg (817-30)	$324
5 mg (817-30) quantity	5 mg (817-30)	$1,295

Urotensin I, suckerfish

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Urotensin I, suckerfish

Related Products

Sarilesin - Angiotensin II [Sar1,Ile8]

ACTH (1-17), human

ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Angiotensin I [Val5,Asn9], bullfrog

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register