Vasoactive Intestinal Peptide (VIP) human, porcine, rat

CAS Number: 40077-57-4 Molecular Weight: 3323. [Read More...]

Description
Additional Information

CAS Number: 40077-57-4
Molecular Weight: 3323.77
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Sequence (1-letter): HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Storage: -20 °C or below

Vasoactive Intestinal Peptide (VIP) is a peptide hormone which has several roles in both the body and the brain. VIP induces smooth muscle relaxation, stimulates water secretion, and inhibits gastric juice secretion in the digestive system. VIP plays a key role as a synchronizing agent in the suprachiasmatic nuclei (SCN) which controls the circadian rhythm.

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (491-25) quantity	0.5 mg (491-25)	$100
1 mg (491-25) quantity	1 mg (491-25)	$184

Vasoactive Intestinal Peptide (VIP) human, porcine, rat

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Vasoactive Intestinal Peptide (VIP) human, porcine, rat

Related Products

Syntide 2, CaMKII Substrate

Tyr(PO3H2)4 Angiotensin II, human

Angiotensin I [Asn1,Val5,Asn9], salmon

Angiotensin I [Asn1,Val5], goosefish

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register